PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.F01779.2.p
Common NameEUGRSUZ_F01779
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family Nin-like
Protein Properties Length: 506aa    MW: 55977.8 Da    PI: 6.5052
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.F01779.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK94.38.6e-30175226152
            RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       aek i+l++l++yF++++kdAAk+Lgvc+T+LKriCRq+GIkRWP+Rkik++
  Eucgr.F01779.2.p 175 AEKAITLQVLRQYFAGSLKDAAKSLGVCPTTLKRICRQHGIKRWPSRKIKKV 226
                       5899**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.564165246IPR003035RWP-RK domain
PfamPF020422.5E-26179226IPR003035RWP-RK domain
SuperFamilySSF542775.33E-21395486No hitNo description
Gene3DG3DSA:3.10.20.2404.3E-20399482No hitNo description
SMARTSM006664.2E-18401484IPR000270PB1 domain
PROSITE profilePS5174522.372401484IPR000270PB1 domain
CDDcd064071.78E-36402482No hitNo description
PfamPF005644.1E-14402483IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 506 aa     Download sequence    Send to blast
MFGLCAAVAI RLRSIHTGTA DFVLEFFLPM DCKDHDKQKK MLGSLSIIIQ QVCQSLRVIT  60
NEELEEETVL PEIPVPSEGR PQGEWSLEVE SNYLERCSEE DLSWSAHVEK VQQSDTVASA  120
TQKARAGESF VEKSLDFGQF QDSSTERGED CSFYGEGRCS DAAREKTGDK KRTKAEKAIT  180
LQVLRQYFAG SLKDAAKSLG VCPTTLKRIC RQHGIKRWPS RKIKKVGHSL QKLQLVMDTV  240
RVQGAPGPLQ IDSFYTNFPE LASPNLSITS PLSASNHGDH LQPLGTQPGA LNFDSCAAVS  300
KSTSSSCSHS SSSSQCCSSG TKQHPSIVDL VAEEDHLVSE NNVDITPSKM VQSHVELQGS  360
SQEEQKLLPR SQSRRSFNPN MENPPRPPPQ YNCQASREGD PLRVKVACAD ENIRFRMQKD  420
WDLKDLWGEI ARRFCIEDTS KFDLKYLDDD SEWVLLTCDA DLDECIDVSR SSPGSTVKLS  480
VRKSHHRRLG SSLGSSGPPR MHGAS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.F01779.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010061177.10.0PREDICTED: protein NLP4-like
RefseqXP_010061178.10.0PREDICTED: protein NLP4-like
TrEMBLA0A059BPS90.0A0A059BPS9_EUCGR; Uncharacterized protein
STRINGPOPTR_0002s01060.11e-146(Populus trichocarpa)
STRINGPOPTR_0005s27310.11e-146(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.18e-87Nin-like family protein